Cosrx The 6 Peptide Skin Booster

COSRX

Cosrx The 6 Peptide Skin Booster

$16.99

lightweightwaterymilkyslipperyviscousserum like
1

This lightweight, watery multi-action serum is designed as the first step after cleansing to prep skin for easy layering. A six-peptide complex, niacinamide, sodium hyaluronate and allantoin help moisturize while improving the look of elasticity, texture, pores, dullness and uneven tone. Suitable for all skin types, including sensitive skin, its slippery, milky texture absorbs quickly without feeling heavy.

Not sure this one fits your skin?

Scan your face in the Thea app and see how this product scores for your skin type, concerns, and routine.

Get the Thea app